Mazdutide – 5mg

Mazdutide – 5mg Research-Grade Dual GLP-1 / GCGR Peptide Agonist

Mazdutide (also known as IBI362 or LY3305677) is a synthetic research peptide designed to function as a dual agonist of the glucagon-like peptide-1 receptor (GLP-1R) and the glucagon receptor (GCGR). In controlled laboratory environments, Mazdutide is used to investigate multi-receptor peptide signaling, metabolic regulatory pathways, intracellular second-messenger cascades, and peptide–receptor activation dynamics.

Peer-reviewed mechanistic research indexed under PMID: 37084350 describes Mazdutide’s receptor-binding properties and dual-pathway biochemical activity, forming the foundation for in-vitro studies exploring GLP-1R/GCGR co-activation, cAMP modulation, receptor cross-talk, and downstream metabolic signaling networks.

As a high-purity lyophilized peptide, Mazdutide supports controlled biochemical characterization, receptor-binding assays, pathway modeling, and in-vitro evaluation of dual-receptor agonist mechanisms where simultaneous GLP-1 and GCGR signaling is of investigative relevance.

Important Information About This Research Product:

  • Your vials are not empty — the lyophilized material collects at the bottom.
  • All products arrive as lyophilized powder requiring reconstitution.
  • Bacteriostatic water is not supplied.
  • Store in a cool, dry environment — short-term at 4°C, long-term at −20°C.
  • This material is strictly for laboratory research use only. No instructions for reconstitution, dosing, or administration can be provided.

$159.99

Order in the next --:--:-- (by 5:00 PM) to get it shipped by Sun, Sep 20.
Quantity
Quantity Discounts
2 - 9
$156.99
10 - 19
$153.99
20 +
$149.99

70 in stock

Lyophilized Powder

Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.

2259884-03-0

C207H317N45O65

4476

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Chemical structure

GLP-1/GIP Dual Agonist Mazdutide

Lyophilized Powder

Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.

2259884-03-0

C207H317N45O65

4476

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Chemical structure

GLP-1/GIP Dual Agonist Mazdutide

NO REVIEWS

Be the first to leave a review.

ADD A REVIEW