Mazdutide – 5mg
Mazdutide – 5mg Research-Grade Dual GLP-1 / GCGR Peptide Agonist
Mazdutide (also known as IBI362 or LY3305677) is a synthetic research peptide designed to function as a dual agonist of the glucagon-like peptide-1 receptor (GLP-1R) and the glucagon receptor (GCGR). In controlled laboratory environments, Mazdutide is used to investigate multi-receptor peptide signaling, metabolic regulatory pathways, intracellular second-messenger cascades, and peptide–receptor activation dynamics.
Peer-reviewed mechanistic research indexed under PMID: 37084350 describes Mazdutide’s receptor-binding properties and dual-pathway biochemical activity, forming the foundation for in-vitro studies exploring GLP-1R/GCGR co-activation, cAMP modulation, receptor cross-talk, and downstream metabolic signaling networks.
As a high-purity lyophilized peptide, Mazdutide supports controlled biochemical characterization, receptor-binding assays, pathway modeling, and in-vitro evaluation of dual-receptor agonist mechanisms where simultaneous GLP-1 and GCGR signaling is of investigative relevance.
Important Information About This Research Product:
- Your vials are not empty — the lyophilized material collects at the bottom.
- All products arrive as lyophilized powder requiring reconstitution.
- Bacteriostatic water is not supplied.
- Store in a cool, dry environment — short-term at 4°C, long-term at −20°C.
- This material is strictly for laboratory research use only. No instructions for reconstitution, dosing, or administration can be provided.
$159.99
70 in stock
Lyophilized Powder
Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.
2259884-03-0
C207H317N45O65
4476
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GLP-1/GIP Dual Agonist Mazdutide
Lyophilized Powder
Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.
2259884-03-0
C207H317N45O65
4476
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GLP-1/GIP Dual Agonist Mazdutide
NO REVIEWS
Be the first to leave a review.




