IGF-1 DES 1, 3 – 1mg

IGF-1 DES (1–3) – 1mg Research-Grade Peptide Fragment

IGF-1 DES (1–3) is a truncated analog of insulin-like growth factor-1, consisting of the IGF-1 sequence lacking the first three N-terminal amino acids. This modification results in significantly reduced binding affinity for IGF-binding proteins (IGFBPs), enabling enhanced receptor availability and increased potency in vitro. Peer-reviewed findings indexed under PMID: 1311388 describe the distinct biochemical behavior of IGF-1 DES compared to native IGF-1, particularly in receptor activation dynamics and local tissue-level signaling models.

In controlled laboratory environments, IGF-1 DES is employed to investigate IGF-1 receptor (IGF-1R) signaling, MAPK/ERK pathway modulation, cellular proliferation models, receptor-ligand kinetics, and biochemical processes that depend on reduced IGFBP interference. Its enhanced bioactivity profile supports use in pathway mapping, mechanistic assays, and receptor-specific in-vitro studies requiring high-intensity signaling.

The lyophilized research-grade peptide offers consistent purity, stability, and reproducibility for laboratory applications requiring controlled IGF-1 analog exposure.

Important Information About This Research Product:

  • Your vials are not empty — the lyophilized material collects at the bottom.
  • All products arrive as lyophilized powder requiring reconstitution.
  • Bacteriostatic water is not supplied.
  • Store in a cool, dry environment — short-term at 4°C, long-term at −20°C.
  • This material is strictly for laboratory research use only. No instructions for reconstitution, dosing, or administration can be provided.

$69.99

Order in the next --:--:-- (by 5:00 PM) to get it shipped by Sun, Sep 20.
Quantity
Quantity Discounts
2 - 9
$66.99
10 - 19
$63.99
20 +
$59.99

130 in stock

Lyophilized Powder

Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.

112603-35-7

C7H11NO2S2

205.3

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Chemical structure

IGF-1 (1-3); Des(1-3) IGF-1

Lyophilized Powder

Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.

112603-35-7

C7H11NO2S2

205.3

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Chemical structure

IGF-1 (1-3); Des(1-3) IGF-1

NO REVIEWS

Be the first to leave a review.

ADD A REVIEW