IGF-1 DES 1, 3 – 1mg
IGF-1 DES (1–3) – 1mg Research-Grade Peptide Fragment
IGF-1 DES (1–3) is a truncated analog of insulin-like growth factor-1, consisting of the IGF-1 sequence lacking the first three N-terminal amino acids. This modification results in significantly reduced binding affinity for IGF-binding proteins (IGFBPs), enabling enhanced receptor availability and increased potency in vitro. Peer-reviewed findings indexed under PMID: 1311388 describe the distinct biochemical behavior of IGF-1 DES compared to native IGF-1, particularly in receptor activation dynamics and local tissue-level signaling models.
In controlled laboratory environments, IGF-1 DES is employed to investigate IGF-1 receptor (IGF-1R) signaling, MAPK/ERK pathway modulation, cellular proliferation models, receptor-ligand kinetics, and biochemical processes that depend on reduced IGFBP interference. Its enhanced bioactivity profile supports use in pathway mapping, mechanistic assays, and receptor-specific in-vitro studies requiring high-intensity signaling.
The lyophilized research-grade peptide offers consistent purity, stability, and reproducibility for laboratory applications requiring controlled IGF-1 analog exposure.
Important Information About This Research Product:
- Your vials are not empty — the lyophilized material collects at the bottom.
- All products arrive as lyophilized powder requiring reconstitution.
- Bacteriostatic water is not supplied.
- Store in a cool, dry environment — short-term at 4°C, long-term at −20°C.
- This material is strictly for laboratory research use only. No instructions for reconstitution, dosing, or administration can be provided.
$69.99
130 in stock
Lyophilized Powder
Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.
112603-35-7
C7H11NO2S2
205.3
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
IGF-1 (1-3); Des(1-3) IGF-1
Lyophilized Powder
Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.
112603-35-7
C7H11NO2S2
205.3
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
IGF-1 (1-3); Des(1-3) IGF-1
NO REVIEWS
Be the first to leave a review.




