Retatrutide – 5mg

Retatrutide – 5mg Research-Grade Tri-Agonist Peptide

Retatrutide is a long-acting synthetic peptide engineered as a triple agonist targeting the GLP-1, GIP, and glucagon receptors. In controlled laboratory environments, it is used to investigate multi-receptor activation, metabolic pathway cross-talk, intracellular signaling interactions, and peptide-mediated modulation of energy regulation systems. Foundational mechanistic and receptor-binding profiles are described under PMID: 37289218.

In vitro, Retatrutide provides a unique model for studying simultaneous activation of three class B GPCR pathways, allowing researchers to evaluate synergistic intracellular messenger formation, receptor selectivity patterns, and combined metabolic-signaling cascades. Its extended-activity structure supports studies requiring prolonged receptor engagement and stable biochemical performance.

Supplied as a high-purity lyophilized peptide, Retatrutide is suitable for mechanistic receptor analysis, peptide–GPCR interaction mapping, intracellular signaling research, and metabolic pathway modeling conducted in controlled laboratory conditions.

Important Information About This Research Product:

  • Your vials are not empty — the lyophilized material collects at the bottom.
  • All products arrive as lyophilized powder requiring reconstitution.
  • Bacteriostatic water is not supplied.
  • Store in a cool, dry environment — short-term at 4°C, long-term at −20°C.
  • This material is strictly for laboratory research use only. No instructions for reconstitution, dosing, or administration can be provided.

$169.99

Order in the next --:--:-- (by 5:00 PM) to get it shipped by Sat, Sep 19.
Quantity
Quantity Discounts
2 - 9
$166.99
10 - 19
$163.99
20 +
$159.99

100 in stock

Lyophilized Powder

Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.

2381089-83-2

C221H342N46O68

4731

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Chemical structure

Egrifta; GHRH Analog Tesamorelin

Lyophilized Powder

Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.

2381089-83-2

C221H342N46O68

4731

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Chemical structure

Egrifta; GHRH Analog Tesamorelin

NO REVIEWS

Be the first to leave a review.

ADD A REVIEW