IGF-1 LR3 – 1mg
IGF-1 LR3 – 1mg Research-Grade Recombinant IGF-1 Analog
IGF-1 LR3 (Long R3 Insulin-Like Growth Factor-1) is a recombinant analog of human IGF-1 engineered with a 13-amino-acid N-terminal extension and an arginine substitution at position 3. These modifications significantly reduce IGF-binding protein (IGFBP) affinity, enhancing receptor accessibility and extending activity in vitro. Mechanistic findings indexed under PMID: 1318405 describe the altered receptor kinetics and potent IGF-1R activation profile associated with LR3 variants.
In controlled laboratory environments, IGF-1 LR3 is utilized to examine IGF-1 receptor signaling, PI3K/Akt and MAPK pathway modulation, cellular proliferation responses, receptor-binding kinetics, and biochemical processes influenced by reduced IGFBP sequestration. Its enhanced potency supports applications in pathway-mapping assays, receptor-stimulation models, and growth factor–dependent biochemical research.
The lyophilized research-grade peptide ensures reproducibility, stability, and consistent purity for laboratory assays requiring reliable IGF-1 analog performance.
Important Information About This Research Product:
- Your vials are not empty — the lyophilized material collects at the bottom.
- All products arrive as lyophilized powder requiring reconstitution.
- Bacteriostatic water is not supplied.
- Store in a cool, dry environment — short-term at 4°C, long-term at −20°C.
- This material is strictly for laboratory research use only. No instructions for reconstitution, dosing, or administration can be provided.
$69.99
120 in stock
Lyophilized Powder
Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.
946870-92-4
C7H11NO2S2
205.3
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Long R3 IGF-1; Recombinant IGF-1 LR3
Lyophilized Powder
Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.
946870-92-4
C7H11NO2S2
205.3
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Long R3 IGF-1; Recombinant IGF-1 LR3
NO REVIEWS
Be the first to leave a review.




