IGF-1 LR3 – 1mg

IGF-1 LR3 – 1mg Research-Grade Recombinant IGF-1 Analog

IGF-1 LR3 (Long R3 Insulin-Like Growth Factor-1) is a recombinant analog of human IGF-1 engineered with a 13-amino-acid N-terminal extension and an arginine substitution at position 3. These modifications significantly reduce IGF-binding protein (IGFBP) affinity, enhancing receptor accessibility and extending activity in vitro. Mechanistic findings indexed under PMID: 1318405 describe the altered receptor kinetics and potent IGF-1R activation profile associated with LR3 variants.

In controlled laboratory environments, IGF-1 LR3 is utilized to examine IGF-1 receptor signaling, PI3K/Akt and MAPK pathway modulation, cellular proliferation responses, receptor-binding kinetics, and biochemical processes influenced by reduced IGFBP sequestration. Its enhanced potency supports applications in pathway-mapping assays, receptor-stimulation models, and growth factor–dependent biochemical research.

The lyophilized research-grade peptide ensures reproducibility, stability, and consistent purity for laboratory assays requiring reliable IGF-1 analog performance.

Important Information About This Research Product:

  • Your vials are not empty — the lyophilized material collects at the bottom.
  • All products arrive as lyophilized powder requiring reconstitution.
  • Bacteriostatic water is not supplied.
  • Store in a cool, dry environment — short-term at 4°C, long-term at −20°C.
  • This material is strictly for laboratory research use only. No instructions for reconstitution, dosing, or administration can be provided.

$69.99

Order in the next --:--:-- (by 5:00 PM) to get it shipped by Sat, Sep 19.
Quantity
Quantity Discounts
2 - 9
$66.99
10 - 19
$63.99
20 +
$59.99

120 in stock

Lyophilized Powder

Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.

946870-92-4

C7H11NO2S2

205.3

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Chemical structure

Long R3 IGF-1; Recombinant IGF-1 LR3

Lyophilized Powder

Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.

946870-92-4

C7H11NO2S2

205.3

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Chemical structure

Long R3 IGF-1; Recombinant IGF-1 LR3

NO REVIEWS

Be the first to leave a review.

ADD A REVIEW