Tesamorelin – 5mg
Tesamorelin – 5mg Research-Grade GHRH Analog
Tesamorelin is a stabilized synthetic analog of growth hormone–releasing hormone (GHRH), incorporating a trans-3-hexenoic acid modification to enhance peptide stability and receptor-binding performance. In controlled laboratory environments, Tesamorelin is used to investigate GHRH receptor activation, cAMP-mediated intracellular signaling, peptide–receptor affinity, and metabolic pathway regulation. Foundational mechanistic studies appear under PMID: 9239430.
In vitro, Tesamorelin enables precise exploration of GHRH-R–mediated pathway activity, receptor-binding kinetics, intracellular messenger formation, and structural influences associated with lipidic side-chain stabilization. Its extended stability and predictable analog behavior make it suitable for comparative GHRH analog studies, mechanistic receptor profiling, and long-duration biochemical assays.
Supplied as a high-purity lyophilized peptide, Tesamorelin supports controlled research applications requiring reproducible GHRH analog performance and detailed analysis of peptide–receptor biochemical interactions.
Important Information About This Research Product:
- Your vials are not empty — the lyophilized material collects at the bottom.
- All products arrive as lyophilized powder requiring reconstitution.
- Bacteriostatic water is not supplied.
- Store in a cool, dry environment — short-term at 4°C, long-term at −20°C.
- This material is strictly for laboratory research use only. No instructions for reconstitution, dosing, or administration can be provided.
$69.99
135 in stock
Lyophilized Powder
Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.
218949-48-5
C221H366N72O67S
5136
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
N-Acetyl Epithalon Amide
Lyophilized Powder
Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.
218949-48-5
C221H366N72O67S
5136
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
N-Acetyl Epithalon Amide
NO REVIEWS
Be the first to leave a review.




