Tesamorelin – 5mg

Tesamorelin – 5mg Research-Grade GHRH Analog

Tesamorelin is a stabilized synthetic analog of growth hormone–releasing hormone (GHRH), incorporating a trans-3-hexenoic acid modification to enhance peptide stability and receptor-binding performance. In controlled laboratory environments, Tesamorelin is used to investigate GHRH receptor activation, cAMP-mediated intracellular signaling, peptide–receptor affinity, and metabolic pathway regulation. Foundational mechanistic studies appear under PMID: 9239430.

In vitro, Tesamorelin enables precise exploration of GHRH-R–mediated pathway activity, receptor-binding kinetics, intracellular messenger formation, and structural influences associated with lipidic side-chain stabilization. Its extended stability and predictable analog behavior make it suitable for comparative GHRH analog studies, mechanistic receptor profiling, and long-duration biochemical assays.

Supplied as a high-purity lyophilized peptide, Tesamorelin supports controlled research applications requiring reproducible GHRH analog performance and detailed analysis of peptide–receptor biochemical interactions.

Important Information About This Research Product:

  • Your vials are not empty — the lyophilized material collects at the bottom.
  • All products arrive as lyophilized powder requiring reconstitution.
  • Bacteriostatic water is not supplied.
  • Store in a cool, dry environment — short-term at 4°C, long-term at −20°C.
  • This material is strictly for laboratory research use only. No instructions for reconstitution, dosing, or administration can be provided.

$69.99

Order in the next --:--:-- (by 5:00 PM) to get it shipped by Sat, Apr 18.
Quantity
Quantity Discounts
2 - 9
$68.59
10 - 19
$67.19
20 +
$65.79

135 in stock

Lyophilized Powder

Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.

218949-48-5

C221H366N72O67S

5136

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Chemical structure

N-Acetyl Epithalon Amide

Lyophilized Powder

Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.

218949-48-5

C221H366N72O67S

5136

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Chemical structure

N-Acetyl Epithalon Amide

NO REVIEWS

Be the first to leave a review.

ADD A REVIEW