Semaglutide – 10mg
Semaglutide – 10mg Research-Grade GLP-1 Analog
Semaglutide is a long-acting synthetic analog of glucagon-like peptide-1 (GLP-1) used in controlled laboratory settings to investigate GLP-1 receptor activation, intracellular signaling mechanisms, and peptide–GPCR biochemical interactions. Foundational mechanistic studies, including enhanced receptor affinity and structural stabilization features, are documented under PMID: 24394611.
In vitro, Semaglutide enables exploration of cyclic AMP (cAMP) production, receptor-binding kinetics, signal transduction cascades, peptide stabilization via fatty-acid chain modification, and GLP-1–mediated metabolic pathway regulation. The molecule’s structural modifications—including Aib substitution and C18 fatty-acid side-chain extension—support prolonged receptor engagement models and extended-duration mechanistic studies.
Supplied as a high-purity lyophilized peptide, Semaglutide is suitable for biochemical assays, GPCR pathway profiling, intracellular signaling research, and structural–functional evaluation of peptide analogs under controlled laboratory conditions.
Important Information About This Research Product:
- Your vials are not empty — the lyophilized material collects at the bottom.
- All products arrive as lyophilized powder requiring reconstitution.
- Bacteriostatic water is not supplied.
- Store in a cool, dry environment — short-term at 4°C, long-term at −20°C.
- This material is strictly for laboratory research use only. No instructions for reconstitution, dosing, or administration can be provided.
$199.99
500 in stock
Lyophilized Powder
Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.
250685-44-0
C187H291N45O59
4114
HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Thymalfasin
Lyophilized Powder
Store all products in a dry, cool, and dark place away from UV rays. For best preservation, store @ 4°C.
250685-44-0
C187H291N45O59
4114
HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Thymalfasin
NO REVIEWS
Be the first to leave a review.




